DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and AT5G51570

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_199970.1 Gene:AT5G51570 / 835231 AraportID:AT5G51570 Length:292 Species:Arabidopsis thaliana


Alignment Length:211 Identity:48/211 - (22%)
Similarity:89/211 - (42%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VIFRLGRIRSCLGPGLVFLLPCIDSFNTVDIRTDVVNVDPQ-EMLTKDSVSITVNAVVFYCIYDP 125
            |:.|.||......||..|..|....:....:.|.:.::|.: |..|||:|.:.:...:.|     
plant    19 VVERWGRFEHIAEPGCHFFNPLAGQWLAGVLSTRIKSLDVKIETKTKDNVFVQLVCSIQY----- 78

  Fly   126 INSIIK--VDDA----RDATERISQV---TLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERW 181
              .::|  .|||    ::..|:|...   .:|.:|....|..|...:.:::..:.:.:.|:...:
plant    79 --RVVKASADDAFYELQNPKEQIQAYVFDVVRALVPMMTLDALFEQKGEVAKSVLEELEKVMGAY 141

  Fly   182 GVRVERVDLMEISLPSSLERS-----------LAS----EAE-------ATREARAKIILAEGEA 224
            |..:|.:.:::|....|:.::           |||    |||       |..||.||.:...|.|
plant   142 GYSIEHILMVDIIPDPSVRKAMNEINAAQRLQLASVYKGEAEKILQVKRAEAEAEAKYLGGVGVA 206

  Fly   225 KASKALKECSDVMSEN 240
            :..:|:   :|.:.||
plant   207 RQRQAI---TDGLREN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 31/162 (19%)
SPFH_like 74..276 CDD:302763 44/199 (22%)
AT5G51570NP_199970.1 SPFH_like_u4 11..280 CDD:259805 48/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.