DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and stoml1

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001103502.1 Gene:stoml1 / 563294 ZFINID:ZDB-GENE-070209-241 Length:410 Species:Danio rerio


Alignment Length:265 Identity:68/265 - (25%)
Similarity:121/265 - (45%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NYIVEKVAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRIRSCLGPGLVFLLPCIDSFNT 89
            :::...:..|:.::...:..|.|....|.:...:.|:|:|||||||...|||:|.:||.||.:..
Zfish    67 SWLCNLIVTFLVFLFTFVTFPISGWFVLKVVPNYERVVVFRLGRIRPPKGPGVVLILPFIDQWQR 131

  Fly    90 VDIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSK 154
            ||:||...|:.|.::.||||..::|.|.:.:.|:.|:.|::.|.|...:|...:|..:...:..|
Zfish   132 VDLRTRAFNIPPCKVCTKDSGLVSVGADIQFRIWSPVMSVVAVQDLNSSTRLTAQNAMMTSLSKK 196

  Fly   155 GLHELLASRQQLSLEIQQAVAKITERWGVRVERVDL------------------MEISLP----- 196
            .|.|:...|.:|...:...:.::|:.||:.|:||:|                  |..|:|     
Zfish   197 SLREIQTDRLKLGEHLGMDMNEMTKPWGLEVDRVELILEGVVREPDGGHSGPLIMPPSVPGLEGL 261

  Fly   197 ----SSLERSLASEAEATREARAKIILAEGEAKASKALKECSDVMSENQITLQLRHLQILCSMAS 257
                ..|.....|:..|::       ..:.....|..|...|.|.|.|::      ::.:.|:.|
Zfish   262 TGPIQQLAMHFLSQTTASQ-------CTQDTVSFSDELHAVSSVSSVNEL------IETVRSVLS 313

  Fly   258 ERRVN 262
            |..|:
Zfish   314 EELVH 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 53/180 (29%)
SPFH_like 74..276 CDD:302763 55/216 (25%)
stoml1NP_001103502.1 PHB 94..232 CDD:214581 48/137 (35%)
SPFH_SLP-1 109..239 CDD:259814 43/129 (33%)
SCP2 301..405 CDD:280250 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.