DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and nphs2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001018155.2 Gene:nphs2 / 557914 ZFINID:ZDB-GENE-051102-2 Length:391 Species:Danio rerio


Alignment Length:317 Identity:101/317 - (31%)
Similarity:169/317 - (53%) Gaps:32/317 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRERYAVETEKQD-----NVEPTPEDDNSNY--IVEKVAVFVSWILVLILLPFSLCCCLTIAYEF 58
            :|||  ::.|:::     ..|...|.....|  :.|.:.:.:...:|::.||.|:..|:.|..|.
Zfish    81 VRER--IKEEREELLALLETEGPGEGLKKKYLGVCELLLIVLVLSVVILFLPISVWFCVKIVREH 143

  Fly    59 HRLVIFRLGRI--RSCLGPGLVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKDSVSITVNAVVFYC 121
            .|.|.||||.:  :...||||:|.||.:|..:.||||..::.:.|..::|||.|...|.||.:|.
Zfish   144 ERAVKFRLGHLLKKRPRGPGLMFYLPFLDVCHIVDIRLQILKIPPHMVVTKDLVCTEVTAVCYYR 208

  Fly   122 I------YDPINSIIKVDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITER 180
            |      |....||      .|..:.::||::|.|:.....:::|..|::::.|||..:...|.|
Zfish   209 IENVSVCYSSFASI------PDVMQALTQVSVREILAHHAFNDILLDRKRIAQEIQVTLDSGTCR 267

  Fly   181 WGVRVERVDLMEISLPSSLERSLASEAEATREARAKIILAEGEAKASKALKECSDVMSENQITLQ 245
            ||::||:.::.||:||..|:.:.|.||||.|:|:.|:|.||||..|.:|||...:.:|.:.:.:.
Zfish   268 WGIKVEKAEIEEINLPPELQHNFAVEAEARRQAQVKVIAAEGEKAACEALKASVESVSGSPLVMH 332

  Fly   246 LRHLQILCSMASERRVNVLFPIPLEIMAPFMD--------GKDSSDAAQDDDDRRDS 294
            ||.||:|.|:.||:.. |:..||.:::...:|        .:..:.....||..:||
Zfish   333 LRLLQLLHSLRSEQPA-VVLNIPPDVLTQSIDLASLTRPANQSMTTCHGSDDGTKDS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 55/161 (34%)
SPFH_like 74..276 CDD:302763 75/207 (36%)
nphs2NP_001018155.2 SPFH_like 134..356 CDD:302763 84/228 (37%)
PHB 135..299 CDD:214581 60/169 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.