DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and stoml3b

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001017825.1 Gene:stoml3b / 550523 ZFINID:ZDB-GENE-050417-366 Length:278 Species:Danio rerio


Alignment Length:249 Identity:114/249 - (45%)
Similarity:177/249 - (71%) Gaps:9/249 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WILVLI-------LLPFSLCCCLTIAYEFHRLVIFRLGRI--RSCLGPGLVFLLPCIDSFNTVDI 92
            ||||:|       :.|.|:...:.|..|:.|.||||||||  |...|||:.|::||.|||..||:
Zfish    28 WILVIISAFFSILVFPISVFISIKIVKEYERAVIFRLGRITARKAKGPGIFFIIPCTDSFIKVDL 92

  Fly    93 RTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLH 157
            ||...::.|||:||||||:::|:.||::.:.||:.|:..|.:|..:|..::|.||||::|:|.|.
Zfish    93 RTVSFDIPPQEILTKDSVTVSVDGVVYFRVNDPVASVANVSNADYSTRLLAQTTLRNVLGTKNLA 157

  Fly   158 ELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLASEAEATREARAKIILAEG 222
            |:|:.|:.:|..:|..:.:.|:.||::||||::.::.||..|:|::|:||||:||||||:|.|||
Zfish   158 EVLSDREGISHSMQTTLDEATDSWGIKVERVEIKDVKLPQQLQRAMAAEAEASREARAKVIAAEG 222

  Fly   223 EAKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPLEIMAPFM 276
            |..||:||||.|.|::|:...||||:||.|.::|:|:...::||:|::||..|:
Zfish   223 EMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIVFPLPIDIMNHFI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 67/155 (43%)
SPFH_like 74..276 CDD:302763 94/201 (47%)
stoml3bNP_001017825.1 PHB 49..200 CDD:214581 65/150 (43%)
SPFH_like 72..270 CDD:302763 92/197 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.