DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and zgc:112408

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001017597.1 Gene:zgc:112408 / 550260 ZFINID:ZDB-GENE-050417-63 Length:291 Species:Danio rerio


Alignment Length:279 Identity:116/279 - (41%)
Similarity:192/279 - (68%) Gaps:15/279 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DNVEPTPEDDNSNYIVEK--------------VAVFVSWILVLILLPFSLCCCLTIAYEFHRLVI 63
            :.:||...:::...::.:              :..|.|.:|:....|.|:..|:.:..|:.|.||
Zfish    11 NKIEPIANEESDTNVIGQSDGDQSKSCGFCGYILTFFSCLLIFFTFPVSVWFCMKVVQEYERAVI 75

  Fly    64 FRLGR-IRSCLGPGLVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPIN 127
            ||||| :....||||.:::||:|:|..||:||...::..||:||||||:..|:|||:|.|::|..
Zfish    76 FRLGRLLGGAKGPGLFWIIPCMDTFRKVDLRTVSFDIPAQEVLTKDSVTTMVDAVVYYRIFNPTV 140

  Fly   128 SIIKVDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERWGVRVERVDLME 192
            ||.||::|..||:.|:|.||||::|:|.|.::|..|:::|.:::..:...::.||::||||:|.:
Zfish   141 SITKVENANYATQMIAQTTLRNMLGTKSLADILKDREEMSEQMEAVLYSASKNWGIKVERVELKD 205

  Fly   193 ISLPSSLERSLASEAEATREARAKIILAEGEAKASKALKECSDVMSENQITLQLRHLQILCSMAS 257
            :.||::|:|::|:||||:|:||||:|.||||.|||:||||.::||||:...||||::|.|..:||
Zfish   206 VKLPTTLQRAMAAEAEASRDARAKVIAAEGEMKASRALKEAANVMSESPAALQLRYMQTLTEIAS 270

  Fly   258 ERRVNVLFPIPLEIMAPFM 276
            ||...::||:|:::|:.||
Zfish   271 ERNSTIIFPVPMDLMSGFM 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 67/154 (44%)
SPFH_like 74..276 CDD:302763 97/201 (48%)
zgc:112408NP_001017597.1 HflC 44..290 CDD:223407 114/246 (46%)
SPFH_like 83..283 CDD:302763 96/199 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.