DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and Phb2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster


Alignment Length:325 Identity:74/325 - (22%)
Similarity:132/325 - (40%) Gaps:80/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HRLVIF-RLGRIRSCL-GPGLVFLLPCIDSFNTVDIRT--------------DVVNVDPQEMLTK 107
            ||.:|| |||.|:|.: ..||...:|........|||:              .::|:..:.:...
  Fly    49 HRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIRSRPRKISSPTGSKDLQMINISLRVLSRP 113

  Fly   108 DSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQ 172
            ||:::..           ::..:.||........|....|::::......:|:..|||:||.|::
  Fly   114 DSLNLPY-----------LHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLIRK 167

  Fly   173 AVAKITERWGVRVERVDLMEISL----PSSLERSLASEAEATR----------EARAKIILAEGE 223
            .:.:....:.:.::.|.|.|:|.    .:::|....::.||.|          |.:.||:.||||
  Fly   168 ELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAEGE 232

  Fly   224 AKASKALKECSDVMSENQITLQLRHLQILCSMA-----SERRVNVLFPIPLEIMAPFMDGKDSSD 283
            |:|:|.|   ...:.:|...|:||.|:...|:|     |:.:|.:                 |:|
  Fly   233 AEAAKML---GLAVKQNPAYLKLRKLRAAQSIARTIASSQNKVYL-----------------SAD 277

  Fly   284 AAQDDDDRRDSDDDYDYLHLFSPKVYISGT--PPDFFNDAQTDSTTEKP-----EVGKTTESVEE 341
            :...:......||       .:.|||..||  |.|:.:..:..|...:|     .||....|:.|
  Fly   278 SLMLNIQDSGFDD-------MTEKVYKIGTGLPKDWLDARKMASKVAQPAEKEKNVGNVASSMAE 335

  Fly   342  341
              Fly   336  335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 34/164 (21%)
SPFH_like 74..276 CDD:302763 48/234 (21%)
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 45/197 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.