DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and stoml2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001004808.1 Gene:stoml2 / 448051 XenbaseID:XB-GENE-1017042 Length:350 Species:Xenopus tropicalis


Alignment Length:217 Identity:57/217 - (26%)
Similarity:111/217 - (51%) Gaps:23/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CLTIAYEFHRLVIF----------RLGRIRSCLGPGLVFLLPCIDSFNTV-DIRTDVVNVDPQEM 104
            ||:.....:.:|:|          |:||....|.|||..|:|.:|....| .::..|:||..|..
 Frog    31 CLSSGLPMNTVVLFVPQQEAWVIERMGRFHRILEPGLNVLIPILDRIRYVQSLKEIVINVPEQSA 95

  Fly   105 LTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLE 169
            ::.|:|::.::.|::..|.||..:...|:|...|..:::|.|:|:.:|...|.::...|:.|:..
 Frog    96 VSLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLTLDKVFRERESLNAN 160

  Fly   170 IQQAVAKITERWGVRVERVDLMEISLPSSLERSLASEAEATREARAKIILAEGEAKASKALKECS 234
            |..|:.:.::.||::..|.::.:|.:|..::.::..:.||.|..||.::.:||       .:|.:
 Frog   161 IVDAINQASDYWGIKCLRYEIKDIHVPPKVKEAMQMQVEAERRKRAMVLESEG-------TRESA 218

  Fly   235 DVMSENQITLQLRHLQILCSMA 256
            ..::|.|     :..|||.|.|
 Frog   219 INVAEGQ-----KQAQILASEA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 42/163 (26%)
SPFH_like 74..276 CDD:302763 49/184 (27%)
stoml2NP_001004808.1 HflC 45..318 CDD:223407 53/203 (26%)
SPFH_paraslipin 78..188 CDD:259811 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.