DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and phb2b

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001002681.2 Gene:phb2b / 436954 ZFINID:ZDB-GENE-040718-430 Length:303 Species:Danio rerio


Alignment Length:225 Identity:60/225 - (26%)
Similarity:105/225 - (46%) Gaps:39/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RLVIF-RLGRIR--SCLGPGLVFLLPCIDSFNTVDIRTDVVNVDPQEM--LTKDSVSITVNAVVF 119
            |.:|| |:|.::  :.|..||.|.:|........|||     ..|:::  ||.......|| :..
Zfish    56 RAIIFNRIGGVQLDTVLTEGLHFRIPWFQYPIIYDIR-----ARPRKISSLTGSKDLQMVN-IAL 114

  Fly   120 YCIYDPINS---IIKVDDARDATER----ISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKI 177
            ..:..|:.|   |:.....:|..||    |....|:::|......:|:..|.|:||.|::.:.:.
Zfish   115 RVLSRPLASNLPIMYQQLGQDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELFER 179

  Fly   178 TERWGVRVERVDLMEISLPSSLERSLASEA----------------EATREARAKIILAEGEAKA 226
            .:.:.:.::.|.:.|:|.  |.|.:.|.||                :|.:|.:.|||.|||||:|
Zfish   180 AKDFNIILDDVAITELSF--SREYTAAVEAKQVAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAQA 242

  Fly   227 SKALKECSDVMSENQITLQLRHLQILCSMA 256
            :|.|.|   .:::|...|:||.::...::|
Zfish   243 AKMLGE---AVTKNPGYLKLRRIRAAQNIA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 38/155 (25%)
SPFH_like 74..276 CDD:302763 54/208 (26%)
phb2bNP_001002681.2 SPFH_prohibitin 49..243 CDD:259799 51/194 (26%)
PHB 49..209 CDD:214581 41/160 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.