DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and CG14736

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster


Alignment Length:400 Identity:214/400 - (53%)
Similarity:260/400 - (65%) Gaps:55/400 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PTP------EDDNSNYIVEKVAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRIRSCL-G 74
            |.|      .:||.:...||||:.:.|.||:|..|||:||||||..|:.|::|.||||:|..| |
  Fly    39 PPPSRYIQTSEDNKDSTFEKVAIGICWFLVIITFPFSMCCCLTIVPEYSRMIILRLGRLRKGLRG 103

  Fly    75 PGLVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDAT 139
            |||||:|||||..:.||:||||.||.||::||||||:|||||||:||||.||:|||:||||:.||
  Fly   104 PGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKDSVTITVNAVVYYCIYSPIDSIIQVDDAKQAT 168

  Fly   140 ERISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLA 204
            :.|||||||||||||.|:.||.||||||.|||||||.||.||||||||||:|:|:||:|||||||
  Fly   169 QLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLA 233

  Fly   205 SEAEATREARAKIILAEGEAKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPL 269
            |||||.|||||||||||||.||||||||.|||||||:|||||||||||.|:||||||.:::||||
  Fly   234 SEAEAVREARAKIILAEGELKASKALKEASDVMSENKITLQLRHLQILSSIASERRVRIIYPIPL 298

  Fly   270 EIMAPFMDGKD-----------------SSDAAQDDDDRRDSDDDYDYLHLFSPKVYISGTPPDF 317
            |||.|||.||:                 ..|.|....:.|.                 .|...|.
  Fly   299 EIMEPFMSGKEGQKKDGGGGGGGGKETKKEDVAGGSKETRK-----------------EGGGSDS 346

  Fly   318 FNDAQTDSTTEK-PEVGKTTESVEENKPARSWLWPPFFRPSRSAQDGEQPTSSRRVRPQSGQPSP 381
            |:...:.....| ...||.    |:|:..|:         ...:.|..:|.||:.....:|:...
  Fly   347 FSGGSSGGLLSKFIFAGKE----EKNQTTRA---------GDKSSDINEPCSSKSFIKGTGEALA 398

  Fly   382 RSNRTDDAIE 391
            .:..||:.:|
  Fly   399 LNQETDEGLE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 113/154 (73%)
SPFH_like 74..276 CDD:302763 160/201 (80%)
CG14736NP_001287293.1 PHB 78..225 CDD:214581 106/146 (73%)
SPFH_like 100..305 CDD:302763 161/204 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0019362
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6471
76.850

Return to query results.
Submit another query.