DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and CG14644

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster


Alignment Length:266 Identity:117/266 - (43%)
Similarity:176/266 - (66%) Gaps:10/266 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DNVEPTPEDDNSNYIVEKVAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRIR--SCLGP 75
            :||.||        ..||....:|.||:::.||:||.|||.:..|:.|.||.||||:|  ...||
  Fly    35 ENVPPT--------CAEKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGP 91

  Fly    76 GLVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATE 140
            |::||:||||....|||||...::..||:||:|.|:|:::.||:|.|..|.:::::|.|..:|||
  Fly    92 GVIFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATE 156

  Fly   141 RISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLAS 205
            :::..||||:.|:..|.:||:|::.||.:|:..:...||.||:|||||::.||.:|..|:|:||.
  Fly   157 KLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAV 221

  Fly   206 EAEATREARAKIILAEGEAKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPLE 270
            |.||.|||:||:..|:||..|..||||.:|:|..|.|.||||:||.|.|:.::...:.:||.|::
  Fly   222 EQEAMREAKAKVAAAQGERDAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVD 286

  Fly   271 IMAPFM 276
            |:...|
  Fly   287 IVRNLM 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 69/155 (45%)
SPFH_like 74..276 CDD:302763 91/201 (45%)
CG14644NP_649445.3 PHB 64..223 CDD:214581 71/158 (45%)
SPFH_like 89..292 CDD:302763 91/202 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473027
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6471
65.850

Return to query results.
Submit another query.