DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and phb

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_989038.1 Gene:phb / 394635 XenbaseID:XB-GENE-977670 Length:272 Species:Xenopus tropicalis


Alignment Length:241 Identity:55/241 - (22%)
Similarity:108/241 - (44%) Gaps:49/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HRLVIFRLGRIR----SCLGPGLVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKD--SVSITVNAV 117
            |:.|||  .|.|    :.:|.|..||:|.:......|.|:...|| |....:||  :|:||:.  
 Frog    34 HQAVIF--DRFRGVQETVVGEGTHFLIPWVQKPIIFDCRSRPRNV-PVVTGSKDLQNVNITLR-- 93

  Fly   118 VFYCIYDPI-NSIIKV--DDARDATER----ISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVA 175
               .::.|: |.:.::  ....|..||    |:...|:::|......||:..|:.:|.::.:.:.
 Frog    94 ---ILFRPMGNQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSEDLM 155

  Fly   176 KITERWGVRVERVDLMEISLPSSLERSLASEAEATREA--------------RAKIILAEGEAKA 226
            :....:|:.::.|.|..::.......::.::..|.:||              :|.:|.|||::||
 Frog   156 ERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFIVEKAEQQKKAAVISAEGDSKA 220

  Fly   227 SK----ALKECSDVMSENQITLQLRHLQ----ILCSMASERRVNVL 264
            ::    :|.:..|.:      ::||.|:    |...::..|.|..|
 Frog   221 AELIATSLADAGDGL------IELRKLEAAEDIAYQLSRARNVTYL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 36/157 (23%)
SPFH_like 74..276 CDD:302763 49/222 (22%)
phbNP_989038.1 SPFH_prohibitin 27..221 CDD:259799 45/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.