DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and stoml2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_957325.1 Gene:stoml2 / 394006 ZFINID:ZDB-GENE-040426-1139 Length:355 Species:Danio rerio


Alignment Length:325 Identity:70/325 - (21%)
Similarity:135/325 - (41%) Gaps:77/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VIFRLGRIRSCLGPGLVFLLPCIDSFNTV-DIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDP 125
            |:.|:||....|.|||.||:|.:|....| .::..|::|..|..::.|:|::.::.|::..|.||
Zfish    53 VVERMGRFHRILEPGLNFLIPILDRIRYVQSLKEIVIDVPEQSAVSLDNVTLQIDGVLYLRILDP 117

  Fly   126 INSIIKVDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERWGVRVERVDL 190
            ..:...|:|...|..:::|.|:|:.:|...|.::...|:.|:..|..::.:.::.||:|..|.::
Zfish   118 FKASYGVEDPEYAVTQLAQTTMRSELGKLTLDKVFRERESLNSNIVHSINQASDEWGIRCLRYEI 182

  Fly   191 MEISLPSSLERSLASEAEATREARAKI-------------------------------------- 217
            .:|.:|..::.|:..:.||.|..||.:                                      
Zfish   183 KDIHVPPRVKESMQMQVEAERRKRATVLESGGTRESAINVAEGRKQAQILASEGEKAEQINKAAG 247

  Fly   218 ----ILAEGEAKASKALKECSDVMSEN------QITLQLRHLQILCSMASERRVNVLFPIPLEIM 272
                :||:.|||| ||::..|:.:::.      .:::..:::.....:|.|...         |:
Zfish   248 EANAVLAKAEAKA-KAIRLLSEALTQQNGNAAASLSVAEQYVSAFSKLAKESNT---------IL 302

  Fly   273 APFMDGKDSSDAAQDDDDRRDSDDDYDYLHLFSPKVYISGTPPDFFNDAQTDSTTEKPEVGKTTE 337
            .|...|..||...|                  :..:|.|.:.....|.|.|..|.:..|....:|
Zfish   303 LPSNTGDISSMVTQ------------------AMTIYGSLSKNQTHNPAVTTMTPDTLEENTASE 349

  Fly   338  337
            Zfish   350  349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 40/142 (28%)
SPFH_like 74..276 CDD:302763 53/250 (21%)
stoml2NP_957325.1 PHB 45..199 CDD:214581 40/145 (28%)
SPFH_paraslipin 79..189 CDD:259811 26/109 (24%)
Band_7_C 264..326 CDD:292817 11/88 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.