DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and CG42540

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001246627.1 Gene:CG42540 / 38562 FlyBaseID:FBgn0260657 Length:517 Species:Drosophila melanogaster


Alignment Length:354 Identity:129/354 - (36%)
Similarity:214/354 - (60%) Gaps:30/354 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRIR--SCLGPGLVFLLPCIDSFNTVDI 92
            |:.:|:|..||::.|||||..|..:..|:.|.|||||||:.  ...|||:.|:||||||:..||:
  Fly   188 KLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDL 252

  Fly    93 RTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLH 157
            ||...:|.|||:||||||:::|:|||:|.:.:...||..|::|..:|..::|.||||.:|::.||
  Fly   253 RTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLH 317

  Fly   158 ELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLASEAEATREARAKIILAEG 222
            |:|:.|..:|..:|..:.:.|:.||::||||::.::.||..|:|::|:||||.||||||:|.|||
  Fly   318 EILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEG 382

  Fly   223 EAKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPLEIMAPFMDGKDSSDAAQD 287
            |.|||:||:|.|:|:.::...||||:||.|.::::|:...::||:|::::..|:   .:::|...
  Fly   383 EQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYFL---KTNEATTQ 444

  Fly   288 DDDRRDSDDDYDYLHLFSPKVYISGTPPDF-FNDAQTDSTTEKPEVGKTTESVEENKPARSWLWP 351
            .:.|             :....|..|||.. ....|.....::|:..:..:..::.:|.:     
  Fly   445 QNAR-------------AAAAAIGNTPPPLQLAPQQQMGQQQQPQYQQPQQQQQQYQPQQ----- 491

  Fly   352 PFFRPSRSAQDGEQPTSSRRVRPQSGQPS 380
                  :..|..:||....::..|..|.|
  Fly   492 ------QQQQQQQQPQQQDQLYQQGQQIS 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 68/155 (44%)
SPFH_like 74..276 CDD:302763 93/201 (46%)
CG42540NP_001246627.1 HflC 188..440 CDD:223407 114/254 (45%)
SPFH_stomatin 229..430 CDD:259801 93/200 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473032
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.