DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and phb

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_005163854.1 Gene:phb / 321346 ZFINID:ZDB-GENE-030131-6577 Length:309 Species:Danio rerio


Alignment Length:238 Identity:58/238 - (24%)
Similarity:105/238 - (44%) Gaps:43/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HRLVIFRLGRIRS----CLGPGLVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKD--SVSITVNAV 117
            ||.|||  .|.|.    .:|.|..||:|.:......|.|:...|| |....:||  :|:||:. :
Zfish    71 HRAVIF--DRFRGVQDVVVGEGTHFLIPWVQKPIIFDCRSRPRNV-PVITGSKDLQNVNITLR-I 131

  Fly   118 VFYCIYDPINSIIKVDDARDATER----ISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKIT 178
            :|..:...:..|. .....|..||    |:...|:::|......||:..|:.:|.::.:.:.:..
Zfish   132 LFRPVAGQLPRIF-TSIGEDYDERVLPSITTEVLKSVVARFDAGELITQRELVSRQVSEDLTERA 195

  Fly   179 ERWGVRVERVDLMEIS----LPSSLERSLASEAEATR----------EARAKIILAEGEAKA--- 226
            ..:|:.::.|.|..::    ...::|....::.||.|          :.:|.||.|||:::|   
Zfish   196 STFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQAAIISAEGDSQAALL 260

  Fly   227 -SKALKECSDVMSENQITLQLRHLQ----ILCSMASERRVNVL 264
             :.:|.|..|.:      ::||.|:    |...::..|.|..|
Zfish   261 IANSLAEAGDGL------VELRKLEAAEDIAFQLSRARNVTYL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 38/158 (24%)
SPFH_like 74..276 CDD:302763 51/219 (23%)
phbXP_005163854.1 PHB 63..224 CDD:214581 38/157 (24%)
SPFH_prohibitin 64..258 CDD:259799 47/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.