DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and Stoml2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001026816.1 Gene:Stoml2 / 298203 RGDID:1308285 Length:353 Species:Rattus norvegicus


Alignment Length:289 Identity:68/289 - (23%)
Similarity:129/289 - (44%) Gaps:63/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VIFRLGRIRSCLGPGLVFLLPCIDSFNTV-DIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDP 125
            |:.|:||....|.|||..|:|.:|....| .::..|:||..|..:|.|:|::.::.|::..|.||
  Rat    48 VVERMGRFHRILEPGLNVLIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDP 112

  Fly   126 INSIIKVDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERWGVRVERVDL 190
            ..:...|:|...|..:::|.|:|:.:|...|.::...|:.|:..|..|:.:..:.||:|..|.::
  Rat   113 YKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIVDAINQAADCWGIRCLRYEI 177

  Fly   191 MEISLPSSLERSLASEAEATREARAKIILAEG---------EAK------ASKALK--------- 231
            .:|.:|..::.|:..:.||.|..||.::.:||         |.|      ||:|.|         
  Rat   178 KDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQAAG 242

  Fly   232 ECSDVMSENQ-----------------------ITLQLRHLQILCSMASERRVNVLFPIPLEI-- 271
            |.|.|:::.:                       :|:..:::.....:|.:....:|...|.::  
  Rat   243 EASAVLAKAKAKAEAIRILAGALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTVLLPSNPSDVTS 307

  Fly   272 -------------MAPFMDGKDSSDAAQD 287
                         .||....::||:|.:|
  Rat   308 MVAQAMGVYGALTKAPVPGAQNSSEARRD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 42/142 (30%)
SPFH_like 74..276 CDD:302763 59/264 (22%)
Stoml2NP_001026816.1 HflC 38..314 CDD:223407 62/265 (23%)
SPFH_paraslipin 74..184 CDD:259811 29/109 (27%)
Band_7_C 259..321 CDD:292817 4/61 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..353 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.