DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and Stom

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001011965.1 Gene:Stom / 296655 RGDID:1305109 Length:284 Species:Rattus norvegicus


Alignment Length:265 Identity:116/265 - (43%)
Similarity:179/265 - (67%) Gaps:7/265 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PEDDNSNYIVEK-----VAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRI--RSCLGPG 76
            ||....|...|.     :.|.||:|.|||..|.|:..|:.|..|:.|::|||||||  ....|||
  Rat    16 PESFRDNSKAELGPCGWILVAVSFIFVLITFPISIWICIKIVKEYERVIIFRLGRILQGGAKGPG 80

  Fly    77 LVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATER 141
            |.|:|||.|||..||:||...::.|||:||||||:|:|:.||:|.:.:...::..:.:|..||..
  Rat    81 LFFILPCTDSFIKVDMRTISFDIPPQEVLTKDSVTISVDGVVYYRVQNATLAVANITNADSATRL 145

  Fly   142 ISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLASE 206
            ::|.||||.:|:|.|.::|:.|::::..:|..:...|:.||::||||::.::.||..|:|::|:|
  Rat   146 LAQTTLRNALGTKNLSQILSDREEIAHHMQSTLDDATDDWGIKVERVEIKDVKLPVQLQRAMAAE 210

  Fly   207 AEATREARAKIILAEGEAKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPLEI 271
            |||.||||||:|.||||..||:||||.|.|::|:...||||:||.|.::|:|:...::||:|:::
  Rat   211 AEAAREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTIVFPLPIDM 275

  Fly   272 MAPFM 276
            :...|
  Rat   276 LQGIM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 65/155 (42%)
SPFH_like 74..276 CDD:302763 91/201 (45%)
StomNP_001011965.1 PHB 53..204 CDD:214581 63/150 (42%)
SPFH_stomatin 73..274 CDD:259801 91/200 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.