DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and Stoml3

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001099901.1 Gene:Stoml3 / 295041 RGDID:1311090 Length:107 Species:Rattus norvegicus


Alignment Length:71 Identity:26/71 - (36%)
Similarity:38/71 - (53%) Gaps:12/71 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TPEDDNSNYIVEK----------VAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRIRS- 71
            :||....|.:|..          :..|:|::|:||..|.|:..||.|..|:.|.|:||||||:: 
  Rat     3 SPEKLEKNNLVGTNKSRLGVCGWILFFLSFLLMLITFPVSIWMCLKIIKEYERAVVFRLGRIQAD 67

  Fly    72 -CLGPG 76
             ..|||
  Rat    68 KAKGPG 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 15/29 (52%)
SPFH_like 74..276 CDD:302763 3/3 (100%)
Stoml3NP_001099901.1 SPFH_like 44..>73 CDD:302763 13/28 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.