powered by:
Protein Alignment CG31358 and Stoml3
DIOPT Version :9
Sequence 1: | NP_001287292.1 |
Gene: | CG31358 / 41462 |
FlyBaseID: | FBgn0051358 |
Length: | 474 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099901.1 |
Gene: | Stoml3 / 295041 |
RGDID: | 1311090 |
Length: | 107 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 26/71 - (36%) |
Similarity: | 38/71 - (53%) |
Gaps: | 12/71 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 TPEDDNSNYIVEK----------VAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRIRS- 71
:||....|.:|.. :..|:|::|:||..|.|:..||.|..|:.|.|:||||||::
Rat 3 SPEKLEKNNLVGTNKSRLGVCGWILFFLSFLLMLITFPVSIWMCLKIIKEYERAVVFRLGRIQAD 67
Fly 72 -CLGPG 76
..|||
Rat 68 KAKGPG 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.