DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and Stoml3

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_694796.1 Gene:Stoml3 / 229277 MGIID:2388072 Length:287 Species:Mus musculus


Alignment Length:267 Identity:115/267 - (43%)
Similarity:182/267 - (68%) Gaps:12/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TPEDDNSNYIVEK----------VAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRIRS- 71
            :||....|.:|..          :..|:|::|:|:..|.|:..||.|..|:.|.|:||||||:: 
Mouse     3 SPEKLEKNNLVGTNKSRLGVCGWILFFLSFLLMLVTFPISVWMCLKIIKEYERAVVFRLGRIQAD 67

  Fly    72 -CLGPGLVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDA 135
             ..||||:.:|||||.|..||:||...|:.|||:||:|||:..|:.||:|.||..::::..|:|.
Mouse    68 KAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDV 132

  Fly   136 RDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLE 200
            ..||..::|.||||::|::.|.::|:.|::::..||..:...||.||:||.||::.::.:|..|:
Mouse   133 HQATFLLAQTTLRNVLGTQTLSQILSGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQ 197

  Fly   201 RSLASEAEATREARAKIILAEGEAKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLF 265
            ||:|:|||||||||||::.||||..|||:||..|.|::|:.:.||||:||.|.::|:|:...::|
Mouse   198 RSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPVALQLRYLQTLTTVATEKNSTIVF 262

  Fly   266 PIPLEIM 272
            |:|:.|:
Mouse   263 PLPMNIL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 68/155 (44%)
SPFH_like 74..276 CDD:302763 93/199 (47%)
Stoml3NP_694796.1 PHB 45..200 CDD:214581 67/154 (44%)
SPFH_like 69..267 CDD:302763 92/197 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.