DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and STOM

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_004090.4 Gene:STOM / 2040 HGNCID:3383 Length:288 Species:Homo sapiens


Alignment Length:253 Identity:109/253 - (43%)
Similarity:176/253 - (69%) Gaps:2/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRI--RSCLGPGLVFLLPCIDSFNTVDIR 93
            :.|..|::..:|..|.|:..|:.|..|:.|.:|||||||  ....||||.|:|||.|||..||:|
Human    33 ILVAFSFLFTVITFPISIWMCIKIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMR 97

  Fly    94 TDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLHE 158
            |...::.|||:||||||:|:|:.||:|.:.:...::..:.:|..||..::|.||||::|:|.|.:
Human    98 TISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQ 162

  Fly   159 LLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLASEAEATREARAKIILAEGE 223
            :|:.|::::..:|..:...|:.||::||||::.::.||..|:|::|:||||:||||||:|.||||
Human   163 ILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAEAEASREARAKVIAAEGE 227

  Fly   224 AKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPLEIMAPFMDGKDS 281
            ..||:||||.|.|::|:...||||:||.|.::|:|:...::||:|::::...:..|.|
Human   228 MNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTIVFPLPIDMLQGIIGAKHS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 65/155 (42%)
SPFH_like 74..276 CDD:302763 91/201 (45%)
STOMNP_004090.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
SPFH_stomatin 73..274 CDD:259801 91/200 (46%)
Required for homooligomerization 265..273 2/7 (29%)
Required for lipid raft association 267..269 0/1 (0%)
Interaction with LANCL1. /evidence=ECO:0000269|PubMed:9512664 273..287 2/13 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.