DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and sto-2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001257021.1 Gene:sto-2 / 180802 WormBaseID:WBGene00006064 Length:375 Species:Caenorhabditis elegans


Alignment Length:240 Identity:109/240 - (45%)
Similarity:176/240 - (73%) Gaps:2/240 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRI--RSCLGPGLVFLLPCIDSFNTVDIRTDVV 97
            :|||:|:...|.|:..|:.:..|:.|.|||||||:  ....|||:.|:||||:|:..||:||...
 Worm   131 LSWIMVISTFPVSIYFCMKVVQEYERAVIFRLGRLIGGGAKGPGIFFVLPCIESYTKVDLRTVSF 195

  Fly    98 NVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLHELLAS 162
            :|.|||:||||||:.:|:||::|.|.:...|:..|::|..:|..::|.||||::|::.|.|:|:.
 Worm   196 SVPPQEILTKDSVTTSVDAVIYYRISNATVSVANVENAHHSTRLLAQTTLRNMLGTRSLSEILSD 260

  Fly   163 RQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLASEAEATREARAKIILAEGEAKAS 227
            |:.|:..:|..:.:.||.||::||||::.::.||..|:|::|:|||||||||||:|.||||.|||
 Worm   261 RETLAASMQTILDEATESWGIKVERVEIKDVRLPIQLQRAMAAEAEATREARAKVIAAEGEQKAS 325

  Fly   228 KALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPLEIM 272
            :||::.:.|::::...||||:||.|.|:|:|:...::||:|:|::
 Worm   326 RALRDAASVIAQSPAALQLRYLQTLNSVAAEKNSTIIFPLPMELV 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 66/155 (43%)
SPFH_like 74..276 CDD:302763 93/199 (47%)
sto-2NP_001257021.1 PHB 146..298 CDD:214581 64/151 (42%)
SPFH_like 168..368 CDD:302763 92/199 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.