DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and Nphs2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_570841.3 Gene:Nphs2 / 170672 RGDID:620461 Length:383 Species:Rattus norvegicus


Alignment Length:246 Identity:78/246 - (31%)
Similarity:153/246 - (62%) Gaps:2/246 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKVAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRI--RSCLGPGLVFLLPCIDSFNTVD 91
            |.:.|..|.|.:::..|||:..|:.:..|:.|::|||||.:  ....||||.|.|||:|:::.||
  Rat   102 EWLLVLSSLIFIIVTFPFSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVD 166

  Fly    92 IRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGL 156
            :|...:.:...|::|||...:.::||.:|.:.:....:..:.....|.:.:.|.|::.::..:.|
  Rat   167 LRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSL 231

  Fly   157 HELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLASEAEATREARAKIILAE 221
            .|:|..|:.::.:::.|:..:|..||::|||.::.::.||:.|:.|||.||||.|:|:.::|.||
  Rat   232 TEILLERKSIAQDVKVALDSVTCVWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAAE 296

  Fly   222 GEAKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPLEIM 272
            ||..||::|:..::::|.....:|||:|..|.|:::::...|:.|:|.:::
  Rat   297 GEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTDKPSTVVLPLPFDML 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 45/155 (29%)
SPFH_like 74..276 CDD:302763 63/199 (32%)
Nphs2NP_570841.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73
SPFH_podocin 122..344 CDD:259809 70/221 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.