DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and Nphs2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_569723.1 Gene:Nphs2 / 170484 MGIID:2157018 Length:385 Species:Mus musculus


Alignment Length:247 Identity:79/247 - (31%)
Similarity:154/247 - (62%) Gaps:2/247 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKVAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRI--RSCLGPGLVFLLPCIDSFNTVD 91
            |.:.|..|.|.:::..|||:..|:.:..|:.|::|||||.:  ....||||.|.|||:|:::.||
Mouse   104 EWLLVLASLIFIIMTFPFSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVD 168

  Fly    92 IRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGL 156
            :|...:.:...|::|||...:.::||.:|.:.:....:..:.....|.:.:.|.|::.::..:.|
Mouse   169 LRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSL 233

  Fly   157 HELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLASEAEATREARAKIILAE 221
            .|:|..|:.::.:::.|:..:|..||::|||.::.::.||:.|:.|||.||||.|:|:.::|.||
Mouse   234 TEILLERKSIAQDVKVALDAVTCIWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAAE 298

  Fly   222 GEAKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPLEIMA 273
            ||..||::|:..::::|.....:|||:|..|.|:::|:...|:.|:|.::::
Mouse   299 GEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPATVVLPLPFDMLS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 45/155 (29%)
SPFH_like 74..276 CDD:302763 64/200 (32%)
Nphs2NP_569723.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
SPFH_podocin 124..346 CDD:259809 71/221 (32%)
PHB 125..289 CDD:214581 51/163 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.