DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and Stom

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_038543.1 Gene:Stom / 13830 MGIID:95403 Length:284 Species:Mus musculus


Alignment Length:265 Identity:112/265 - (42%)
Similarity:176/265 - (66%) Gaps:7/265 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PEDDNSNYIVEK-----VAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGRI--RSCLGPG 76
            ||....|...|.     :.|..|:..|:|..|.|:..|:.|..|:.|::|||||||  ....|||
Mouse    16 PESFRENSKTELGACGWILVAASFFFVIITFPISIWICIKIVKEYERVIIFRLGRILQGGAKGPG 80

  Fly    77 LVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIKVDDARDATER 141
            |.|:|||.||...||:||...::.|||:||||||:|:|:.||:|.:.:...::..:.:|..||..
Mouse    81 LFFILPCTDSLIKVDMRTISFDIPPQEVLTKDSVTISVDGVVYYRVQNATLAVANITNADSATRL 145

  Fly   142 ISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLPSSLERSLASE 206
            ::|.||||.:|:|.|.::|:.|::::..:|..:...|:.||::||||::.::.||..|:|::|:|
Mouse   146 LAQTTLRNALGTKNLSQILSDREEIAHHMQSTLDDATDDWGIKVERVEIKDVKLPVQLQRAMAAE 210

  Fly   207 AEATREARAKIILAEGEAKASKALKECSDVMSENQITLQLRHLQILCSMASERRVNVLFPIPLEI 271
            |||.||||||:|.||||..||:||||.|.|::|:...||||:||.|.::|:|:...::||:|:::
Mouse   211 AEAAREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTIVFPLPVDM 275

  Fly   272 MAPFM 276
            :...|
Mouse   276 LQGIM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 64/155 (41%)
SPFH_like 74..276 CDD:302763 90/201 (45%)
StomNP_038543.1 PHB 53..204 CDD:214581 62/150 (41%)
SPFH_stomatin 73..274 CDD:259801 90/200 (45%)
Required for homooligomerization. /evidence=ECO:0000250 265..273 2/7 (29%)
Required for lipid raft association. /evidence=ECO:0000250 267..269 0/1 (0%)
Interaction with LANCL1. /evidence=ECO:0000250 273..284 1/8 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.