DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and Phb2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_031557.2 Gene:Phb2 / 12034 MGIID:102520 Length:299 Species:Mus musculus


Alignment Length:264 Identity:65/264 - (24%)
Similarity:118/264 - (44%) Gaps:58/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HRLVIF-RLGRIR--SCLGPGLVFLLPCIDSFNTVDIRTDVVNVDPQEML----TKD----SVSI 112
            ||.:.| |:|.::  :.|..||.|.:|........|||     ..|:::.    :||    ::|:
Mouse    47 HRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIR-----ARPRKISSPTGSKDLQMVNISL 106

  Fly   113 TV----NAVVFYCIYDPINSIIKVDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQA 173
            .|    ||.....:|..:.    :|........|....|:::|......:|:..|.|:||.|::.
Mouse   107 RVLSRPNAQELPSMYQRLG----LDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRE 167

  Fly   174 VAKITERWGVRVERVDLMEISLPSSLERSLASEA----------------EATREARAKIILAEG 222
            :.:..:.:.:.::.|.:.|:|.  |.|.:.|.||                :|.:|.|.||:.|||
Mouse   168 LTERAKDFSLILDDVAITELSF--SREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEG 230

  Fly   223 EAKASKALKECSDVMSENQITLQLRHLQILCSMA-----SERRV-----NVLFPIPLEIMAPFMD 277
            ||:|:|.|.|   .:|:|...::||.::...:::     |:.|:     |::..:..|   .|..
Mouse   231 EAEAAKMLGE---ALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDE---SFTR 289

  Fly   278 GKDS 281
            |.||
Mouse   290 GSDS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 36/159 (23%)
SPFH_like 74..276 CDD:302763 55/239 (23%)
Phb2NP_031557.2 Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 19..49 1/1 (100%)
SPFH_prohibitin 40..235 CDD:259799 49/198 (25%)
Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 150..174 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.