DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31358 and nphs2

DIOPT Version :9

Sequence 1:NP_001287292.1 Gene:CG31358 / 41462 FlyBaseID:FBgn0051358 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_017949096.1 Gene:nphs2 / 100498000 XenbaseID:XB-GENE-485101 Length:376 Species:Xenopus tropicalis


Alignment Length:303 Identity:91/303 - (30%)
Similarity:164/303 - (54%) Gaps:16/303 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ETEKQDNVEPTPEDDNSN----YIVEKVAVFVSWILVLILLPFSLCCCLTIAYEFHRLVIFRLGR 68
            |||....:|.:.:||...    .:.|.:.:|...:||::.||.|:..|:.:..|:.|.|||||||
 Frog    71 ETEIMALLETSQKDDGVKPAGFRVFEGLLIFCCLLLVILTLPLSIWFCVKVVREYERAVIFRLGR 135

  Fly    69 IRS--CLGPGLVFLLPCIDSFNTVDIRTDVVNVDPQEMLTKDSVSITVNAVVFYCIYDPINSIIK 131
            :.|  ..||||.|.|||:|..:.||.|.....|...:::|||.|::.::.:.:|.:.:....:..
 Frog   136 MLSGRARGPGLFFYLPCLDKCHKVDFRLKTFEVPFHQIVTKDLVTLEIDVICYYRLENACLFLTS 200

  Fly   132 VDDARDATERISQVTLRNIVGSKGLHELLASRQQLSLEIQQAVAKITERWGVRVERVDLMEISLP 196
            |.....|.:.:.|.|.:.::..:...::|..|:.:..|::.|:...|..||::|||.::.::.||
 Frog   201 VSSISSAFQLLVQTTTKRLLAHRAFLDILLERKSIGEEVKVALDAATCHWGIKVERTEIKDVKLP 265

  Fly   197 SSLERSLASEAEATREARAKIILAEGEAKASKALKECSDVMSENQITLQLRHLQILCSMASERRV 261
            ..:::|:|.||||.|.|:.|:|.||||...|:.:|..::.:|.:...:|||:|..|..|.||:..
 Frog   266 EEVKQSMAVEAEAQRHAKVKVIAAEGEKTVSEYIKLAAEKLSGSPTAIQLRYLHTLQCMTSEKPA 330

  Fly   262 NVLFPIPLEIM-----APFMDGKDSSDAAQDDDD-----RRDS 294
            ..:.|:|.::|     |...:...:.:..:.|:|     ::||
 Frog   331 TFVLPLPFDLMNLNAVARLPEINPTPNTPKSDNDTEQGTKKDS 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31358NP_001287292.1 PHB 50..204 CDD:214581 46/155 (30%)
SPFH_like 74..276 CDD:302763 63/206 (31%)
nphs2XP_017949096.1 SPFH_podocin 116..338 CDD:259809 71/221 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.