DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt3 and TAF13

DIOPT Version :9

Sequence 1:NP_650146.1 Gene:Spt3 / 41461 FlyBaseID:FBgn0037981 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_171768.2 Gene:TAF13 / 837962 AraportID:AT1G02680 Length:126 Species:Arabidopsis thaliana


Alignment Length:107 Identity:30/107 - (28%)
Similarity:49/107 - (45%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 AGGASGSNVANVLIPDDAPVSLL-TEIADIMRSFGDSDQPRTGSVKLVEQILQQQLRGIFNEASL 144
            |..:|.|..|....|.:...:|. .|:..:|..|||...|...||.|||.|:.:.:..:.::|..
plant     9 ASSSSKSKAAGTSQPQEKRKTLFQKELQHMMYGFGDEQNPLPESVALVEDIVVEYVTDLTHKAQE 73

  Fly   145 VAMRRKQNPCPSQADFEFLMRNHPVKIARMRKHLKDMRILKR 186
            :..:|.:....   ||.:|:|....|:.|.|:.|.....||:
plant    74 IGSKRGRLLVD---DFLYLIRKDLPKLNRCRELLAMQEELKQ 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt3NP_650146.1 TAF13 99..190 CDD:173962 25/89 (28%)
TAF13NP_171768.2 TAF13 28..118 CDD:173962 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11380
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.