DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt3 and TAF13

DIOPT Version :9

Sequence 1:NP_650146.1 Gene:Spt3 / 41461 FlyBaseID:FBgn0037981 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_005636.1 Gene:TAF13 / 6884 HGNCID:11546 Length:124 Species:Homo sapiens


Alignment Length:120 Identity:29/120 - (24%)
Similarity:52/120 - (43%) Gaps:14/120 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 NPSPQQINLAGHNVAGGASGSNVANVLIPDDAPVSLLTEIADIMRSFGDSDQPRTGSVKLVEQIL 131
            :|:.::.|   ..:.|||.|.......:       ...|:..:|..|||...|.|.||.::|.::
Human     7 DPTFEEEN---EEIGGGAEGGQGKRKRL-------FSKELRCMMYGFGDDQNPYTESVDILEDLV 61

  Fly   132 QQQLRGIFNEASLVAMRRKQNPCPSQADFEFLMRNHPVKIARMRKHLKDMRILKR 186
            .:.:..:.::|..:..:.:    ....|..||:|..|.|.||::..|.....|||
Human    62 IEFITEMTHKAMSIGRQGR----VQVEDIVFLIRKDPRKFARVKDLLTMNEELKR 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt3NP_650146.1 TAF13 99..190 CDD:173962 23/88 (26%)
TAF13NP_005636.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 6/23 (26%)
TAF13 29..118 CDD:173962 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2300
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.