DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt3 and supt3h

DIOPT Version :9

Sequence 1:NP_650146.1 Gene:Spt3 / 41461 FlyBaseID:FBgn0037981 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_012825709.1 Gene:supt3h / 394640 XenbaseID:XB-GENE-955786 Length:449 Species:Xenopus tropicalis


Alignment Length:356 Identity:91/356 - (25%)
Similarity:153/356 - (42%) Gaps:78/356 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PQQINLAGHNVAGGASGSNVANVLIPDDAPVSLLTEIADIMRSFGDSDQPRTGSVKLVEQILQQQ 134
            |..:..||.:.:|...|..           .|.:.|:..:|.|.||:.:|...:..|||.|:..|
 Frog     8 PNSMASAGTSSSGRGIGKT-----------TSFVPELQSMMFSLGDARRPLHETAVLVEDIVHTQ 61

  Fly   135 LRGIFNEASLVAMRRKQNPCPSQADFEFLMRNHPVKIARMRKHL--KD--MRILK---------R 186
            |..:..:|:.|:..|..... |..|..||||....|:.|:.|::  :|  .::||         :
 Frog    62 LINLLQQAAEVSQMRGARVI-SAEDLLFLMRRDKKKLRRLLKYMVFRDYKSKVLKGIEEEDIEEK 125

  Fly   187 FLSI------RTGRPQDFMDDLEQQ------EEDEELAIDVYELHDEDRMRRLFRADRISQILTG 239
            |.|.      |....|||::.::|.      .||:|:        ||.:..|:.||::.::.:..
 Frog   126 FNSSNNNANKRQKLAQDFLNSIDQTGELLALMEDDEI--------DEVKQERMERAEKQTRAMDP 182

  Fly   240 QQYLEFNEARKTSFYCRHGEKIKNKFRRFLDLPA-DLRIPTPTMNILAYLAHETIAAIVDYSILT 303
            .||.||.|:|:.||     .|..:|||.:||..: :::.....|.||||||:|::|.:||.::|.
 Frog   183 AQYAEFCESRQLSF-----SKKASKFRDWLDCSSMEIKPNAVAMEILAYLAYESVAQLVDLALLV 242

  Fly   304 RLNSDNRATEPYSRVTSAG-----------GSPAMMHVCPEVTQGRGMEVVKPISVPEIHE---- 353
            :.:...:..:|::...||.           ...|.:..||:..:........|.||...|:    
 Frog   243 KQDMTPKTCDPFTHAVSATYIQSRNTAELLAQTAPLKSCPDTPENTPPATPNPPSVGAQHQGKGQ 307

  Fly   354 ------------AMRRFRQMSSRKIGRYRNS 372
                        |.:|.|:.|:...|...||
 Frog   308 AGALGNGVDSNKAKQRKRKKSAAAGGTEANS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt3NP_650146.1 TAF13 99..190 CDD:173962 29/103 (28%)
supt3hXP_012825709.1 TFIID-18kDa 28..119 CDD:190265 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I4983
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1552679at2759
OrthoFinder 1 1.000 - - FOG0006269
OrthoInspector 1 1.000 - - oto103696
Panther 1 1.100 - - LDO PTHR11380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.