DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt3 and Taf13

DIOPT Version :9

Sequence 1:NP_650146.1 Gene:Spt3 / 41461 FlyBaseID:FBgn0037981 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_610024.1 Gene:Taf13 / 35297 FlyBaseID:FBgn0032847 Length:136 Species:Drosophila melanogaster


Alignment Length:93 Identity:28/93 - (30%)
Similarity:41/93 - (44%) Gaps:12/93 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 EIADIMRSFGDSDQPRTGSVKLVEQILQQQLRGIFNEASLVAMRRKQNPCPSQADFEFLMRNHPV 169
            |:..:|..|||...|.|.:|.|:|.::.:.:.    |.:..||...:.......|..||:|..|.
  Fly    41 ELRCMMFGFGDDKNPYTETVDLLEDLVIEYIA----ETTHRAMEIGRTGRVQVEDIIFLVRKDPR 101

  Fly   170 KIAR------MRKHLKDMRILKRFLSIR 191
            |.||      |.:.||..|  |.|..|:
  Fly   102 KYARVKDLLTMNEELKKAR--KAFDEIK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt3NP_650146.1 TAF13 99..190 CDD:173962 27/90 (30%)
Taf13NP_610024.1 TAF13 35..124 CDD:173962 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11380
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2300
SonicParanoid 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.