DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt3 and taf13

DIOPT Version :9

Sequence 1:NP_650146.1 Gene:Spt3 / 41461 FlyBaseID:FBgn0037981 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_588527.2 Gene:taf13 / 2538695 PomBaseID:SPCC1494.02c Length:111 Species:Schizosaccharomyces pombe


Alignment Length:89 Identity:22/89 - (24%)
Similarity:46/89 - (51%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 EIADIMRSFGDSDQPRTGSVKLVEQILQQQLRGIFNEASLVAMRRKQNPCPSQADFEFLMRNHPV 169
            ::..:|.:|||...|...|:.::|:|:...:..:..||:.:|..|.:   ....||:|.:|:.|.
pombe    21 DLKSLMYAFGDDVNPAPDSINVLEEIVVDYINEMCLEAARIAGNRNK---VKVDDFKFALRDDPK 82

  Fly   170 KIAR------MRKHLKDMRILKRF 187
            |:.|      ::|.:.|.|.:.::
pombe    83 KLGRVEELLVLQKMIADTRNVMKY 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt3NP_650146.1 TAF13 99..190 CDD:173962 22/89 (25%)
taf13NP_588527.2 TAF13 10..>97 CDD:242920 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2300
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.