DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCC185 and AT2G30060

DIOPT Version :10

Sequence 1:NP_001097755.1 Gene:GCC185 / 41459 FlyBaseID:FBgn0037979 Length:1135 Species:Drosophila melanogaster
Sequence 2:NP_180567.1 Gene:AT2G30060 / 817557 AraportID:AT2G30060 Length:217 Species:Arabidopsis thaliana


Alignment Length:242 Identity:51/242 - (21%)
Similarity:101/242 - (41%) Gaps:39/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 AQLSNSQQAAQEKLQKIKQLQSRVEELEQANADAQSDVLSTSTISRAEELSRLRELDEGYEEKYH 522
            |.:||..:.           ::|.||...||.|..:.. ..:.|.|.||::    :..|.|::..
plant     2 ASISNEPER-----------ENRDEEETGANEDEDTGA-QVAPIVRLEEVA----VTTGEEDEDT 50

  Fly   523 KLRAIAAKLKKKLQEQTQQLNEMEQSGALKEELEAIKLAQAQLQQDLNAARAENQKLKSKEKVKH 587
            .|     .||.||....:..::.::.||     ..:|..:.::...:.....:::.|    |:..
plant    51 IL-----DLKSKLYRFDKDGSQWKERGA-----GTVKFLKHRVSGKIRLVMRQSKTL----KICA 101

  Fly   588 SSVLNLEIEAAEKSLSEVSAKLTAKSSELEAVKESL-----ASKEN--TIVQLRKEIAILEEAKN 645
            :.::...:...|.:.::.|....|:......:|:.|     ||.||  ..:|..||:|..||.|.
plant   102 NHLVGSGMSVQEHAGNDKSCVWHARDFSDGELKDELFCIRFASVENCKAFMQKFKEVAESEEEKE 166

  Fly   646 GEAAHSLELKEQIDRMQVQVKDAVHSKQQALTQNKDLEHGVEQAKLE 692
             |:..:.:....::::.|:.|::.....:...:||..| .||:.|.|
plant   167 -ESKDASDTAGLLEKLTVEEKESEKKPVEKAEENKKSE-AVEEKKTE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCC185NP_001097755.1 PRK03918 <33..559 CDD:235175 22/100 (22%)
Smc <357..>920 CDD:440809 51/242 (21%)
Grip 1057..1103 CDD:197860
AT2G30060NP_180567.1 RanBD_RanBP1 27..157 CDD:270000 26/148 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.