DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCC185 and RANBP1

DIOPT Version :9

Sequence 1:NP_001097755.1 Gene:GCC185 / 41459 FlyBaseID:FBgn0037979 Length:1135 Species:Drosophila melanogaster
Sequence 2:NP_001265568.1 Gene:RANBP1 / 5902 HGNCID:9847 Length:278 Species:Homo sapiens


Alignment Length:211 Identity:48/211 - (22%)
Similarity:93/211 - (44%) Gaps:44/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 EELEQANADAQSDVLSTSTISRAEELSRLRELDEGYEEKYHKLRAIAAKLKKKLQEQTQQLNEME 546
            |..:::|.|.|.:.:    :|..|:  .::.|:|. ||:..|:|   |||.:...|  ..|.|.:
Human    93 ENTDESNHDPQFEPI----VSLPEQ--EIKTLEED-EEELFKMR---AKLFRFASE--NDLPEWK 145

  Fly   547 QSGA-----LK-EELEAIKLAQAQLQQDLNAARAENQKLKSKEKVKHSS------VLNLEIEAAE 599
            :.|.     || :|..||:|.   :::|.......|..:....::|.::      |.|...:.|:
Human   146 ERGTGDVKLLKHKEKGAIRLL---MRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFAD 207

  Fly   600 KSLSEVSAKLTAKSSELEAVK----ESLASKENTIVQLRKEIAILE-EAKNGEAAHSLELKEQID 659
            :          ....||.|::    |:....:....:.||||...| :|.:|:..|:.::.|:::
Human   208 E----------CPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLE 262

  Fly   660 RMQV--QVKDAVHSKQ 673
            .:.|  :.|:....||
Human   263 ALSVKEETKEDAEEKQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCC185NP_001097755.1 SMC_prok_B 35..813 CDD:274008 48/211 (23%)
TMPIT 458..>548 CDD:285135 18/65 (28%)
GRIP 1058..1100 CDD:279767
RANBP1NP_001265568.1 RanBD_RanBP1 101..237 CDD:270000 33/160 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.