Sequence 1: | NP_001097755.1 | Gene: | GCC185 / 41459 | FlyBaseID: | FBgn0037979 | Length: | 1135 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265568.1 | Gene: | RANBP1 / 5902 | HGNCID: | 9847 | Length: | 278 | Species: | Homo sapiens |
Alignment Length: | 211 | Identity: | 48/211 - (22%) |
---|---|---|---|
Similarity: | 93/211 - (44%) | Gaps: | 44/211 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 482 EELEQANADAQSDVLSTSTISRAEELSRLRELDEGYEEKYHKLRAIAAKLKKKLQEQTQQLNEME 546
Fly 547 QSGA-----LK-EELEAIKLAQAQLQQDLNAARAENQKLKSKEKVKHSS------VLNLEIEAAE 599
Fly 600 KSLSEVSAKLTAKSSELEAVK----ESLASKENTIVQLRKEIAILE-EAKNGEAAHSLELKEQID 659
Fly 660 RMQV--QVKDAVHSKQ 673 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GCC185 | NP_001097755.1 | SMC_prok_B | 35..813 | CDD:274008 | 48/211 (23%) |
TMPIT | 458..>548 | CDD:285135 | 18/65 (28%) | ||
GRIP | 1058..1100 | CDD:279767 | |||
RANBP1 | NP_001265568.1 | RanBD_RanBP1 | 101..237 | CDD:270000 | 33/160 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5171 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |