DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCC185 and Ranbp1

DIOPT Version :9

Sequence 1:NP_001097755.1 Gene:GCC185 / 41459 FlyBaseID:FBgn0037979 Length:1135 Species:Drosophila melanogaster
Sequence 2:NP_001101794.1 Gene:Ranbp1 / 360739 RGDID:1310521 Length:203 Species:Rattus norvegicus


Alignment Length:193 Identity:45/193 - (23%)
Similarity:76/193 - (39%) Gaps:42/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 IEAAEKSLSEVSAKL--TAKSSELEAVKES-------LASKE-NTIVQLRKEIAILEEAKNGEAA 649
            :|..|:.|.::.|||  .|..::|...||.       |..|| .||..|.:....|:...|....
  Rat    41 LEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYIT 105

  Fly   650 HSLELKEQIDRMQVQVKDAVHSKQQALTQNKDLEHGVEQAKLEAEQLRLQLSESAQQYESKLNTA 714
            ..:|||...            ...:|...|...:...|..|.|...:|...:|:||::::|....
  Rat   106 PMMELKPNA------------GSDRAWVWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEEC 158

  Fly   715 TQQLLSQTQELEMHLAEQKRLETALRNAERALEDLRVEYTEYKLKAQSVLRKNQNKGSNREQE 777
            .:::    :|.|      |:......|||:..|         ||:|.|| |:.:::...:.:|
  Rat   159 RKEI----EERE------KKGPGKNDNAEKVAE---------KLEALSV-REARDEAEEKSEE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCC185NP_001097755.1 SMC_prok_B 35..813 CDD:274008 45/193 (23%)
TMPIT 458..>548 CDD:285135
GRIP 1058..1100 CDD:279767
Ranbp1NP_001101794.1 RanBD_RanBP1 24..160 CDD:270000 31/130 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.