DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLHL18 and AT5G38670

DIOPT Version :9

Sequence 1:NP_001262494.1 Gene:KLHL18 / 41458 FlyBaseID:FBgn0037978 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_198683.1 Gene:AT5G38670 / 833857 AraportID:AT5G38670 Length:291 Species:Arabidopsis thaliana


Alignment Length:229 Identity:44/229 - (19%)
Similarity:75/229 - (32%) Gaps:91/229 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 LSTVEVYDPR----------------KNKWSQGCAMLCKRSAVGVAALDDCIYVCGGYDGVTSLN 401
            :::.|:|..|                .|.|.:|..:..|..:.....||:.|||.|......|: 
plant    42 IASPELYKTRSLLDRTESCLYILYCTSNTWHEGPRLRVKLMSCTACVLDEKIYVSGRCKDGDSM- 105

  Fly   402 TVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGGHDGLSIFDSVERYDQAEDVWVKMSPM 466
            |.:|:...:.||                            |.||:..|..::|            
plant   106 TFQVFDTNTQTW----------------------------DPLSVPCSETKHD------------ 130

  Fly   467 LNRRCRLGVATLNGKIYVCGGYCGNSFLRSVECYDPQTDTWKLVTP--------MNCKRSRVALA 523
                ....:...:||:::..       .:.|:.|:.:...|.||||        .:|.|      
plant   131 ----FHYKIVRFDGKLHLVS-------YKGVDAYNSKEGRWDLVTP
SIEHNKYLYDCYR------ 178

  Fly   524 ANMGKLW--AIGGYDGESNLST-VEVYDPETDKW 554
             |:|.:|  .:.|     ::|| |..|..|..:|
plant   179 -NIGNVWYTIVKG-----DISTSVWWYHSEEREW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLHL18NP_001262494.1 BTB 29..135 CDD:279045
PHA03098 36..510 CDD:222983 28/172 (16%)
BACK 143..245 CDD:285009
Kelch 292..339 CDD:128874
KELCH repeat 329..372 CDD:276965 6/34 (18%)
Kelch 340..386 CDD:128874 8/48 (17%)
KELCH repeat 376..417 CDD:276965 11/40 (28%)
Kelch 387..433 CDD:128874 9/45 (20%)
KELCH repeat 423..466 CDD:276965 5/42 (12%)
Kelch 435..480 CDD:128874 5/44 (11%)
Kelch_1 469..514 CDD:279660 9/52 (17%)
KELCH repeat 470..514 CDD:276965 9/51 (18%)
Kelch_1 517..560 CDD:279660 11/41 (27%)
KELCH repeat 517..560 CDD:276965 11/41 (27%)
AT5G38670NP_198683.1 F-box 10..53 CDD:279040 3/10 (30%)
Kelch_2 81..123 CDD:284956 14/70 (20%)
KELCH repeat 81..121 CDD:276965 12/68 (18%)
KELCH repeat 124..165 CDD:276965 9/63 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.