DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLHL18 and AT5G28160

DIOPT Version :9

Sequence 1:NP_001262494.1 Gene:KLHL18 / 41458 FlyBaseID:FBgn0037978 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_198168.1 Gene:AT5G28160 / 832891 AraportID:AT5G28160 Length:324 Species:Arabidopsis thaliana


Alignment Length:394 Identity:76/394 - (19%)
Similarity:127/394 - (32%) Gaps:162/394 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SFLQL-SNVRDACASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKVSQSEEFLAL 182
            |||.| ..:..:|.:.:...::|...|..:||...:|..:||.|                     
plant     9 SFLSLPDEIILSCLARISRSYYPKLSLVCKTFRTLLISNELIVA--------------------- 52

  Fly   183 DCEQLLELMRRDELNVRTEEVIFEACMK------------WVKYAEDKRSELFPQVLAAVRLPLL 235
                        .|:::|.|.....|:|            |:|          |..:...:|   
plant    53 ------------RLHLKTHETFCHVCLKFPDKPNPSMFTLWIK----------PGTILTNQL--- 92

  Fly   236 SPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGLLQSFRTRQRSGEFFTGQIYAVGGLA 300
                       |:..||:...|.:...:..::.:|....::.|             ::|   ||:
plant    93 -----------EKNKRSTRDTRLVQIPSSYYYNVPFYLVMVGS-------------EVY---GLS 130

  Fly   301 STGESVSTVEIYDP----LTKKWKMGEQMSMMRSRVGVAVLNGKLYAFGGFNGTERLSTVEVYDP 361
            ...:..|.:.:.:.    |.|    ...|::.|::....|.|||:|..||....|.::..||:|.
plant   131 QRNDPSSNMFVRNKGDIFLCK----APNMTVARAKASAVVFNGKIYVMGGCMADESVNWGEVFDI 191

  Fly   362 RKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGYDGVTSLNTVEVY----YPKSNTWKTVAQMMKY 422
            :...|.               ||.|    .|.....:|:..::|:    |.:||..|        
plant   192 KTQTWE---------------ALPD----PGPEFRFSSIRKIDVFQEKLYVRSNEKK-------- 229

  Fly   423 RSAGGVTQLNGYVYALGGHDGLSIFDSVERYDQAEDVW--VKMSPMLNRRCRLGVATL-----NG 480
                                     |||  ||..|: |  ||...||||  .||..|:     .|
plant   230 -------------------------DSV--YDPKEE-WRVVKGLDMLNR--NLGCGTIEIVHYGG 264

  Fly   481 KIYV 484
            |:.:
plant   265 KLLI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLHL18NP_001262494.1 BTB 29..135 CDD:279045 5/16 (31%)
PHA03098 36..510 CDD:222983 76/394 (19%)
BACK 143..245 CDD:285009 16/113 (14%)
Kelch 292..339 CDD:128874 9/50 (18%)
KELCH repeat 329..372 CDD:276965 13/42 (31%)
Kelch 340..386 CDD:128874 11/45 (24%)
KELCH repeat 376..417 CDD:276965 10/44 (23%)
Kelch 387..433 CDD:128874 7/49 (14%)
KELCH repeat 423..466 CDD:276965 9/44 (20%)
Kelch 435..480 CDD:128874 16/51 (31%)
Kelch_1 469..514 CDD:279660 6/21 (29%)
KELCH repeat 470..514 CDD:276965 5/20 (25%)
Kelch_1 517..560 CDD:279660
KELCH repeat 517..560 CDD:276965
AT5G28160NP_198168.1 F-box 8..55 CDD:279040 13/78 (17%)
Kelch_1 158..203 CDD:279660 16/63 (25%)
KELCH repeat 159..202 CDD:276965 16/61 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.