DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLHL18 and AT3G24610

DIOPT Version :9

Sequence 1:NP_001262494.1 Gene:KLHL18 / 41458 FlyBaseID:FBgn0037978 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001319634.1 Gene:AT3G24610 / 822057 AraportID:AT3G24610 Length:375 Species:Arabidopsis thaliana


Alignment Length:234 Identity:51/234 - (21%)
Similarity:86/234 - (36%) Gaps:51/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 PQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGLLQSFRTRQRSGEF 288
            |:.:|.:.|..:|      |:....|...|..||.::       |.||      .::||...|  
plant    32 PEAVAMICLARVS------RLDHAALSLVSKSCRSMV-------LSPE------LYQTRSLIG-- 75

  Fly   289 FTGQIYAVGGLASTGESVS-----------TVEIYDPLTKKWKMGEQMSMMRSRVGVAVLNGKLY 342
            :..:...|.....|.|::.           .|...|..:.||.....|.:.|....|:|::||:.
plant    76 YAEKFLYVCFCMPTDETLCCHEKINGNRSLNVLFLDCRSHKWHHVTSMRVARVSPEVSVVDGKIN 140

  Fly   343 AFGGFNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGYDGVTSLNTVEVYY 407
            .:||..........||:||:...|:.        .::.....::.|||...:|       |..||
plant   141 VWGGCKYKHYYDWGEVFDPKTQTWAD--------MSIPKPVREEKIYVVDSWD-------VGSYY 190

  Fly   408 --PKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGGHDGL 444
              |..:.|:...|..| ||..... ::..:|:.|...|:
plant   191 YLPSKSIWEKGNQDSK-RSKDWCL-IDKLIYSCGNDGGI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLHL18NP_001262494.1 BTB 29..135 CDD:279045
PHA03098 36..510 CDD:222983 51/234 (22%)
BACK 143..245 CDD:285009 5/20 (25%)
Kelch 292..339 CDD:128874 11/57 (19%)
KELCH repeat 329..372 CDD:276965 12/42 (29%)
Kelch 340..386 CDD:128874 8/45 (18%)
KELCH repeat 376..417 CDD:276965 9/42 (21%)
Kelch 387..433 CDD:128874 13/47 (28%)
KELCH repeat 423..466 CDD:276965 5/22 (23%)
Kelch 435..480 CDD:128874 3/10 (30%)
Kelch_1 469..514 CDD:279660
KELCH repeat 470..514 CDD:276965
Kelch_1 517..560 CDD:279660
KELCH repeat 517..560 CDD:276965
AT3G24610NP_001319634.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.