DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLHL18 and AT2G44700

DIOPT Version :9

Sequence 1:NP_001262494.1 Gene:KLHL18 / 41458 FlyBaseID:FBgn0037978 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_181998.1 Gene:AT2G44700 / 819078 AraportID:AT2G44700 Length:368 Species:Arabidopsis thaliana


Alignment Length:191 Identity:44/191 - (23%)
Similarity:76/191 - (39%) Gaps:39/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 STVEVYDPRKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGY--DGVTS----LNTVEVYYPKSNT 412
            |.:.::|.|..:..||..:|.||....|..:...:||.|||  |.:.:    |||        .|
plant   144 SRLSIFDTRFGELRQGPCLLVKRGYNCVGLVGGKVYVIGGYQDDEIAAESFDLNT--------QT 200

  Fly   413 WKTVAQMMKYRSAGGVTQLN----GYVYALGGHDGLSIFD----SVERYDQAEDVWVKMSPMLNR 469
            |:......:..|...:.:.|    ..|.||...:|::.:|    |.:|.:...|.|         
plant   201 WEAAPIPDEKESHRWICKANVSFDRKVCALRSREGMTCYDTRDGSCQRSEMPNDQW--------- 256

  Fly   470 RCRLGVATLNGKIYVCGGYCGNSFLRSVECYDPQTDTWKLVTPMNCKRSR-VALAANMGKL 529
             .|:|:..::..::|.....|      :..||.:...|::|...:...:| |.:....|||
plant   257 -SRVGLCVIDNVLFVYFSRFG------LMWYDSKLMLWRVVYGFDLDNARSVGIGEYYGKL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLHL18NP_001262494.1 BTB 29..135 CDD:279045
PHA03098 36..510 CDD:222983 38/169 (22%)
BACK 143..245 CDD:285009
Kelch 292..339 CDD:128874
KELCH repeat 329..372 CDD:276965 5/17 (29%)
Kelch 340..386 CDD:128874 9/31 (29%)
KELCH repeat 376..417 CDD:276965 13/46 (28%)
Kelch 387..433 CDD:128874 13/55 (24%)
KELCH repeat 423..466 CDD:276965 11/50 (22%)
Kelch 435..480 CDD:128874 11/48 (23%)
Kelch_1 469..514 CDD:279660 8/44 (18%)
KELCH repeat 470..514 CDD:276965 8/43 (19%)
Kelch_1 517..560 CDD:279660 5/14 (36%)
KELCH repeat 517..560 CDD:276965 5/14 (36%)
AT2G44700NP_181998.1 F-box 28..73 CDD:279040
KELCH repeat 123..162 CDD:276965 5/17 (29%)
KELCH repeat 166..207 CDD:276965 13/48 (27%)
Kelch_1 166..205 CDD:279660 13/46 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.