DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLHL18 and AT2G41360

DIOPT Version :9

Sequence 1:NP_001262494.1 Gene:KLHL18 / 41458 FlyBaseID:FBgn0037978 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001318401.1 Gene:AT2G41360 / 818734 AraportID:AT2G41360 Length:373 Species:Arabidopsis thaliana


Alignment Length:243 Identity:56/243 - (23%)
Similarity:86/243 - (35%) Gaps:95/243 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 FTGQIYAVGGLASTGESVSTVEIYDPLTKKWKM------GEQMSMMRSRVGVAVLNGKLYA--FG 345
            |.|:|:.:..|.   :..:..::||..|:.||:      .|:.....:.|....|.||:||  ||
plant   160 FDGKIHVIQDLK---QDETEEQVYDLETQTWKVVGVPVPDEKADSRPNMVSSVSLEGKVYAKDFG 221

  Fly   346 GFN------GTERLSTVEVYDPRKNKWSQGCAMLCKRSAV--------GVAALDDCIYVCGGYDG 396
            ..:      || |...:|:  |..::|   .:.:|..:.|        |:..||           
plant   222 SISVYNLRQGT-RKEKLEL--PIDDRW---VSCMCVANNVLFAFFTKYGLLWLD----------- 269

  Fly   397 VTSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVY--ALGGHDG-LSIFDSVERY----- 453
             |.||         |.|:.|        .|.|..|:..:|  |:..:.| |:||.. |||     
plant   270 -TKLN---------NVWRVV--------TGDVQTLHRKLYGSAMAEYYGKLAIFWR-ERYISTSI 315

  Fly   454 -----------DQAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCG 490
                       .:.|.:|..:. .|||              |..|.||
plant   316 NTTKNNNNNNKKKEEKIWSALI-ALNR--------------VGDGICG 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLHL18NP_001262494.1 BTB 29..135 CDD:279045
PHA03098 36..510 CDD:222983 56/243 (23%)
BACK 143..245 CDD:285009
Kelch 292..339 CDD:128874 10/52 (19%)
KELCH repeat 329..372 CDD:276965 14/50 (28%)
Kelch 340..386 CDD:128874 15/61 (25%)
KELCH repeat 376..417 CDD:276965 9/48 (19%)
Kelch 387..433 CDD:128874 9/45 (20%)
KELCH repeat 423..466 CDD:276965 14/61 (23%)
Kelch 435..480 CDD:128874 14/63 (22%)
Kelch_1 469..514 CDD:279660 5/22 (23%)
KELCH repeat 470..514 CDD:276965 4/21 (19%)
Kelch_1 517..560 CDD:279660
KELCH repeat 517..560 CDD:276965
AT2G41360NP_001318401.1 F-box 9..52 CDD:395521
KELCH repeat 106..149 CDD:276965
KELCH repeat 153..205 CDD:276965 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.