DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLHL18 and CG14785

DIOPT Version :10

Sequence 1:NP_650143.1 Gene:KLHL18 / 41458 FlyBaseID:FBgn0037978 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster


Alignment Length:140 Identity:34/140 - (24%)
Similarity:61/140 - (43%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 QNVQNLMVGASFLQLSNVRDACASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKV 173
            |.::.|....|.::..|...|..::|..|:||.    .|...:.|:.|         |.:.|..:
  Fly   227 QLLRQLRSSLSKMEFFNEDTAFKAYLEVRYHPQ----ARILCELMLTR---------ISRVFLCI 278

  Fly   174 SQSEEFLALDCEQLLELMRRDELNVRTEEVIFEACMKWVKYAEDKRSELFPQVLAAVRLPLLSPQ 238
            ..|..||.....:|..::|...|:|.:|..||.:.:.|:::...:|.:...::||.|...|:...
  Fly   279 VGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNWLERGDCAERILAEVHFALMPTW 343

  Fly   239 FLA--DRVAR 246
            :|.  ||..|
  Fly   344 YLCTLDRSNR 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLHL18NP_650143.1 BTB_POZ_KLHL18 20..137 CDD:349556 6/27 (22%)
PHA03098 36..510 CDD:222983 34/140 (24%)
KELCH repeat 329..372 CDD:276965
KELCH repeat 376..417 CDD:276965
KELCH repeat 423..466 CDD:276965
KELCH repeat 470..514 CDD:276965
Kelch_1 517..560 CDD:396078
KELCH repeat 517..560 CDD:276965
CG14785NP_569912.2 BACK 256..345 CDD:197943 23/101 (23%)
DUF4734 359..450 CDD:434992
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.