| Sequence 1: | NP_001262494.1 | Gene: | KLHL18 / 41458 | FlyBaseID: | FBgn0037978 | Length: | 575 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001319995.1 | Gene: | AT4G19330 / 28720147 | AraportID: | AT4G19330 | Length: | 383 | Species: | Arabidopsis thaliana |
| Alignment Length: | 201 | Identity: | 50/201 - (24%) |
|---|---|---|---|
| Similarity: | 77/201 - (38%) | Gaps: | 31/201 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 292 QIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMMRSRVGVAVLNGKLYAFGGFNGTERLSTV 356
Fly 357 EVYDPRKNKW--------------------SQGCAMLCKRSAVGVAALDDCIY-VCGGYDGVTSL 400
Fly 401 NTVEVYYPKSNT--WKTVAQMMKYRSAGGVTQLNGYVYA---LGGHDG-LSIF--DSVERYDQAE 457
Fly 458 DVWVKM 463 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| KLHL18 | NP_001262494.1 | BTB | 29..135 | CDD:279045 | |
| PHA03098 | 36..510 | CDD:222983 | 50/201 (25%) | ||
| BACK | 143..245 | CDD:285009 | |||
| Kelch | 292..339 | CDD:128874 | 13/46 (28%) | ||
| KELCH repeat | 329..372 | CDD:276965 | 17/62 (27%) | ||
| Kelch | 340..386 | CDD:128874 | 14/65 (22%) | ||
| KELCH repeat | 376..417 | CDD:276965 | 9/43 (21%) | ||
| Kelch | 387..433 | CDD:128874 | 13/48 (27%) | ||
| KELCH repeat | 423..466 | CDD:276965 | 13/47 (28%) | ||
| Kelch | 435..480 | CDD:128874 | 8/35 (23%) | ||
| Kelch_1 | 469..514 | CDD:279660 | |||
| KELCH repeat | 470..514 | CDD:276965 | |||
| Kelch_1 | 517..560 | CDD:279660 | |||
| KELCH repeat | 517..560 | CDD:276965 | |||
| AT4G19330 | NP_001319995.1 | F-box | 34..76 | CDD:306992 | |
| BTB | <122..241 | CDD:333434 | 25/95 (26%) | ||
| NanM | 180..>326 | CDD:330881 | 35/145 (24%) | ||
| Kelch_1 | 181..226 | CDD:279660 | 15/44 (34%) | ||
| KELCH repeat | 182..224 | CDD:276965 | 15/41 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||