DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment KLHL18 and bath-35

DIOPT Version :9

Sequence 1:	NP_001262494.1	Gene:	KLHL18 / 41458	FlyBaseID:	FBgn0037978	Length:	575	Species:	Drosophila melanogaster
Sequence 2:	NP_001370035.1	Gene:	bath-35 / 24104973	WormBaseID:	WBGene00012196	Length:	266	Species:	Caenorhabditis elegans

Alignment Length:	125	Identity:	32/125 - (25%)
Similarity:	55/125 - (44%)	Gaps:	18/125 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    22 FGESFPLFKEIRRMGKLCDVTLKVEDQTFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESA 86
            |||      |.|   .:.||.:.|:::.|...::.|||...:|..:|.|    |...||.:  ..
Worm   104 FGE------ETR---DVSDVVINVQNEKFHVSKMFLAAQSSHFKLLFKN----SNDSEIAL--DG 153

  Fly    87 IEPSALESLINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASFLI--SRFHPHNVL 144
            |.|...::.:..:| |:..:...:|:.::..|:...:|.|......||:  |.|.|...|
Worm   154 IIPEDFQNFLELLY-GEPALTEDSVEGILQIAARFDVSTVIRKGEDFLLQKSEFSPEKKL 212

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
KLHL18	NP_001262494.1	BTB	29..135	CDD:279045	24/105 (23%)
		PHA03098	36..510	CDD:222983	27/111 (24%)
		BACK	143..245	CDD:285009	1/2 (50%)
		Kelch	292..339	CDD:128874
		KELCH repeat	329..372	CDD:276965
		Kelch	340..386	CDD:128874
		KELCH repeat	376..417	CDD:276965
		Kelch	387..433	CDD:128874
		KELCH repeat	423..466	CDD:276965
		Kelch	435..480	CDD:128874
		Kelch_1	469..514	CDD:279660
		KELCH repeat	470..514	CDD:276965
		Kelch_1	517..560	CDD:279660
		KELCH repeat	517..560	CDD:276965
bath-35	NP_001370035.1	BTB	112..204	CDD:395526	23/98 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910