Sequence 1: | NP_001262494.1 | Gene: | KLHL18 / 41458 | FlyBaseID: | FBgn0037978 | Length: | 575 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494028.2 | Gene: | btb-12 / 191109 | WormBaseID: | WBGene00022555 | Length: | 261 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 38/198 - (19%) |
---|---|---|---|
Similarity: | 75/198 - (37%) | Gaps: | 48/198 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 RTFADSMICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEACMKW 211
Fly 212 VKYAED---KRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERR 273
Fly 274 G----LLQSFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMMRSRVGV 334
Fly 335 AVL 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
KLHL18 | NP_001262494.1 | BTB | 29..135 | CDD:279045 | |
PHA03098 | 36..510 | CDD:222983 | 38/198 (19%) | ||
BACK | 143..245 | CDD:285009 | 20/100 (20%) | ||
Kelch | 292..339 | CDD:128874 | 9/46 (20%) | ||
KELCH repeat | 329..372 | CDD:276965 | 4/9 (44%) | ||
Kelch | 340..386 | CDD:128874 | |||
KELCH repeat | 376..417 | CDD:276965 | |||
Kelch | 387..433 | CDD:128874 | |||
KELCH repeat | 423..466 | CDD:276965 | |||
Kelch | 435..480 | CDD:128874 | |||
Kelch_1 | 469..514 | CDD:279660 | |||
KELCH repeat | 470..514 | CDD:276965 | |||
Kelch_1 | 517..560 | CDD:279660 | |||
KELCH repeat | 517..560 | CDD:276965 | |||
btb-12 | NP_494028.2 | BTB | 111..200 | CDD:197585 | 23/115 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |