DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLHL18 and bath-1

DIOPT Version :9

Sequence 1:NP_001262494.1 Gene:KLHL18 / 41458 FlyBaseID:FBgn0037978 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_494156.1 Gene:bath-1 / 186648 WormBaseID:WBGene00019139 Length:302 Species:Caenorhabditis elegans


Alignment Length:172 Identity:48/172 - (27%)
Similarity:73/172 - (42%) Gaps:38/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KEIRRMGK----LCDVTLKVEDQTFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIEPS 90
            |::|...|    ..||.|.|||:.|...|..||:...||.::.....||:...||  |..||...
 Worm   133 KKLRSFEKSEEQFSDVVLAVEDKKFFVLRKFLASHSSYFKSLLLGTFAEADKSEI--KHEAINSI 195

  Fly    91 ALESLINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDA------CASFLISRFHPHNVLGIRTF 149
            ..::.:..:| |:..||:.:|:.:      |.|:::.|.      |..|||.:..          
 Worm   196 DFQNFLEVLY-GEPVIDDDDVEGI------LHLAHMYDVPVAIRKCEEFLIEKSE---------- 243

  Fly   150 ADSMICRQLIDAADKYIDQN-----FAKVSQSEEF-LALDCE 185
             .||  |..::.|.||...|     .:||:..||. .||.|:
 Worm   244 -KSM--RDQLEIAKKYQLDNLKKSCLSKVNTVEEIKAALMCD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLHL18NP_001262494.1 BTB 29..135 CDD:279045 32/114 (28%)
PHA03098 36..510 CDD:222983 46/166 (28%)
BACK 143..245 CDD:285009 14/49 (29%)
Kelch 292..339 CDD:128874
KELCH repeat 329..372 CDD:276965
Kelch 340..386 CDD:128874
KELCH repeat 376..417 CDD:276965
Kelch 387..433 CDD:128874
KELCH repeat 423..466 CDD:276965
Kelch 435..480 CDD:128874
Kelch_1 469..514 CDD:279660
KELCH repeat 470..514 CDD:276965
Kelch_1 517..560 CDD:279660
KELCH repeat 517..560 CDD:276965
bath-1NP_494156.1 MATH 12..124 CDD:279285
BTB 141..239 CDD:279045 29/106 (27%)
BTB 147..242 CDD:197585 31/103 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.