DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment KLHL18 and bath-26

DIOPT Version :9

Sequence 1:	NP_001262494.1	Gene:	KLHL18 / 41458	FlyBaseID:	FBgn0037978	Length:	575	Species:	Drosophila melanogaster
Sequence 2:	NP_494005.2	Gene:	bath-26 / 173531	WormBaseID:	WBGene00020329	Length:	314	Species:	Caenorhabditis elegans

Alignment Length:	130	Identity:	29/130 - (22%)
Similarity:	57/130 - (43%)	Gaps:	27/130 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   141 HNVL---GIRTFADS-MICRQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMR-RDELNVRT 200
            |.||   |.:.:|.: :||....|..:..:.:....|.::|:  .||.:..||.:. .|.::..|
Worm   164 HVVLVAGGQKFYARTVVICNPNTDICELDVARGTEIVLENED--PLDLQIFLEALHGEDVISDTT 226

  Fly   201 EEV------------IFEACMKWVKYAEDKRSELFP--QVLAAVRLPL--LSPQFLADRVAREEL 249
            .|:            ||..|.||:.    :.|::.|  |:..|:|...  |..:.|::...::::
Worm   227 LEIILLLAIKYRAIEIFSKCEKWLL----EGSKMSPRKQLQMAIRCSFWELEQKCLSELKTKQDI 287

Fly 250 249
Worm 288 287

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
KLHL18	NP_001262494.1	BTB	29..135	CDD:279045
		PHA03098	36..510	CDD:222983	29/130 (22%)
		BACK	143..245	CDD:285009	28/122 (23%)
		Kelch	292..339	CDD:128874
		KELCH repeat	329..372	CDD:276965
		Kelch	340..386	CDD:128874
		KELCH repeat	376..417	CDD:276965
		Kelch	387..433	CDD:128874
		KELCH repeat	423..466	CDD:276965
		Kelch	435..480	CDD:128874
		Kelch_1	469..514	CDD:279660
		KELCH repeat	470..514	CDD:276965
		Kelch_1	517..560	CDD:279660
		KELCH repeat	517..560	CDD:276965
bath-26	NP_494005.2	MATH	30..142	CDD:334312
bath-26	NP_494005.2	BTB	165..252	CDD:383002	21/92 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000