DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ect3 and AT3G53050

DIOPT Version :10

Sequence 1:NP_650142.1 Gene:Ect3 / 41457 FlyBaseID:FBgn0260746 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_190873.1 Gene:AT3G53050 / 824471 AraportID:AT3G53050 Length:142 Species:Arabidopsis thaliana


Alignment Length:40 Identity:11/40 - (27%)
Similarity:18/40 - (45%) Gaps:4/40 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 VLFTNDGPSVLRCGKIQGVLATMDFGATNDLKPIWAKFRR 248
            :.:.:.|.|...|||.:    ..:.||:|.|..:..|..|
plant    86 ITYADYGQSTGSCGKFK----RGNCGASNTLNIVNKKCLR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ect3NP_650142.1 Glyco_hydro_35 32..350 CDD:396048 11/40 (28%)
BetaGal_dom4_5 <576..616 CDD:463857
AT3G53050NP_190873.1 Gal_Rha_Lectin_BGal 73..141 CDD:438699 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.