DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ect3 and b3gat1b

DIOPT Version :9

Sequence 1:NP_650142.1 Gene:Ect3 / 41457 FlyBaseID:FBgn0260746 Length:637 Species:Drosophila melanogaster
Sequence 2:XP_002663665.1 Gene:b3gat1b / 100332644 ZFINID:ZDB-GENE-131101-1 Length:336 Species:Danio rerio


Alignment Length:160 Identity:32/160 - (20%)
Similarity:53/160 - (33%) Gaps:70/160 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 PGLADRGYVYVDGE------------------------FVGILARETPVFELPLSASAGRRFQII 471
            |.|...|.||...:                        |||.|..|:|.                
Zfish   185 PRLGQSGVVYFADDDNTYSLELFEEMRWTHKASVWPVAFVGGLRYESPK---------------- 233

  Fly   472 VENQGRINYGRQLNDFKGILRDVRLDKQVLSNWNMTQFPLESYDNLEQLITQSDEA------VRQ 530
            :.:||:::..|.:.|.:   |...:|        |..|.:    || |||....:|      |:.
Zfish   234 INSQGKVSGWRTVFDPR---RPFAID--------MAGFAV----NL-QLILSKPQAYFKLKGVKG 282

  Fly   531 GFQELKKLRTMLRTGPAIYHGQLDIQKESD 560
            |:||...|:.::...        |::.::|
Zfish   283 GYQESSLLQDLVTLS--------DLEPKAD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ect3NP_650142.1 Glyco_hydro_35 32..350 CDD:279624
BetaGal_dom4_5 <576..616 CDD:290101
b3gat1bXP_002663665.1 Glyco_transf_43 106..315 CDD:281369 32/160 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.