DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tk and Tac1

DIOPT Version :9

Sequence 1:NP_001262493.1 Gene:Tk / 41456 FlyBaseID:FBgn0037976 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_036798.1 Gene:Tac1 / 24806 RGDID:3807 Length:130 Species:Rattus norvegicus


Alignment Length:101 Identity:25/101 - (24%)
Similarity:48/101 - (47%) Gaps:22/101 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EEERLRDSLLQDF---FDRVAGRDGSAVGKRAPTGFTGMRGKRPALLAGDDDAEADEAT------ 184
            :.:::::::.:.|   ..|:|.|.       .|..|.|:.|||.|    |...|...|.      
  Rat    36 DSDQIKEAMPEPFEHLLQRIARRP-------KPQQFFGLMGKRDA----DSSIEKQVALLKALYG 89

  Fly   185 --ELQQKRAPVNSFVGMRGKKDVSHQHYKRAALSDF 218
              ::..||...:||||:.||:.::...|:|:|:.::
  Rat    90 HGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNY 125



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.