DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mfas and SPAC22H12.05c

DIOPT Version :9

Sequence 1:NP_788655.1 Gene:mfas / 41455 FlyBaseID:FBgn0260745 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_593117.1 Gene:SPAC22H12.05c / 2541828 PomBaseID:SPAC22H12.05c Length:728 Species:Schizosaccharomyces pombe


Alignment Length:393 Identity:80/393 - (20%)
Similarity:155/393 - (39%) Gaps:106/393 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 NLMDIIRERADMSIMRTVLEKTNLSAMLEDDKPVTIFVPTDAAF--DKLEPHLRRALKEGRGCAS 515
            :::|::..::..|.:...|::..|...|..:|.:|:|.|.:.||  |.:||:|...:........
pombe    31 SIIDLLSSKSQFSKLIRRLQRNRLVPYLNRNKGLTLFAPLNEAFPDDSIEPNLLYYIVNTTELDR 95

  Fly   516 NILKNHLLDLTFCSLATVPGAKTTAYNLLGEPLLLNRTHRAANQTGPTPIYINNLAKIIDADIMG 580
            ::|:..|              |::.    |:.:.|...::|  :||.....:|| |:|:.::...
pombe    96 SVLRTQL--------------KSSD----GQQIALKIHYKA--ETGRAYDKVNN-AQIVQSNWRA 139

  Fly   581 TNGVLHVIDTILPTESALP---MTSLMSQKNLTIFQRLLEASGYDDQFDDLDNVTIFAPTDKAL- 641
            .:||:.|||.|:.    ||   :..|.|:|:.:||.||..|     ...:..:||:..|...|. 
pombe   140 DSGVVQVIDNIID----LPPPALEILSSEKDFSIFHRLSVA-----WVGEYSSVTMLVPDSSAFL 195

  Fly   642 ---QNTEWA-----------RMLKEQPELLNHNL---DLLEFLNYHVVKPMIKTCDLSEKSLPTV 689
               .|||.|           :.|..|..|:|..:   |::|...:|...                
pombe   196 NVYTNTELAYLYSMYAAEDVKTLIHQHILVNQRVYAEDVIEPKTFHYKN---------------- 244

  Fly   690 AGSSVRLNLYSTHALFSDVMNRATVNCARLVHFDDESCGSVLHQVDRALAPPKNNMLKLLEANPN 754
             |.|:.:.       |.....:..:|......:|..:....:|.|...:.|      :::...| 
pombe   245 -GISISMK-------FDKDQKKLFINDVSTTKYDLLTFSGAIHTVSSLINP------EIISFTP- 294

  Fly   755 YSKFLELVRKANLTQLLSNDSRSLT--------LLVPKNDIFEELNESGEGSKPADPMALVKTHI 811
             :|:|..:..|..::.||.:.:|::        :|.|.|..:.|:.:             :..||
pombe   295 -AKYLIGIGAAWFSEKLSRERKSISVDKTSKRAILAPTNWAYREIID-------------IDYHI 345

  Fly   812 VED 814
            :|:
pombe   346 IEN 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mfasNP_788655.1 FAS1 339..450 CDD:214719
Fasciclin 462..592 CDD:280607 31/131 (24%)
Fasciclin 607..740 CDD:280607 28/150 (19%)
Fasciclin 753..875 CDD:280607 14/70 (20%)
SPAC22H12.05cNP_593117.1 Fasciclin 40..151 CDD:280607 31/131 (24%)
FAS1 78..422 CDD:225214 68/346 (20%)
Fasciclin 179..287 CDD:295423 22/131 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2335
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100594
Panther 1 1.100 - - O PTHR10900
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1830
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.