DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and KCNAB3

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_011522370.1 Gene:KCNAB3 / 9196 HGNCID:6230 Length:411 Species:Homo sapiens


Alignment Length:275 Identity:70/275 - (25%)
Similarity:106/275 - (38%) Gaps:73/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGSLPATFVKGFHDEEKVRRMEYRQLGSTGLRVSKIALG-GATLSKLFSDDFDREEGILTVQEA 64
            |:...|:.|.|              .||.:|||||.:.|| ..|.....||  :..|.:|||  |
Human    22 MAAKTPSNFTK--------------NLGKSGLRVSCLGLGTWVTFGSQISD--ETAEDVLTV--A 68

  Fly    65 IRSGINYIDTAPFYGQGKSEELLGQALKDV--PREAYYIATKVARYELDPNNMFDYTAAKAR--- 124
            ...|:|..|||..|..||:|..||..||..  .|.:|.|.||:            :...:|.   
Human    69 YEHGVNLFDTAEVYAAGKAERTLGNILKSKGWRRSSYVITTKI------------FWGGQAETER 121

  Fly   125 --------ESVKRSLELLQLDRVDVLQVHDVDAAPSLDMVLNETIPVLEEYVQAGKARFIGVTAY 181
                    |.::.|||.|||..||::..:..|  |:..|  .|.:..:...:..|.|.:.|.:.:
Human   122 GLSRKHIIEGLRGSLERLQLGYVDIVFANRSD--PNCPM--EEIVRAMTYVINQGLALYWGTSRW 182

  Fly   182 DVDVLKECAERGK--GRIQVVLNYARYTLL--DNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNAG 242
            ....:.|.....:  ..|..|...|.:.|.  :...::..:.:.::|||.|              
Human   183 GAAEIMEAYSMARQFNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVGSV-------------- 233

  Fly   243 PQSWHPGSPELLAVG 257
              :|:|     ||.|
Human   234 --TWYP-----LACG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 66/254 (26%)
Aldo_ket_red 24..322 CDD:294321 66/252 (26%)
KCNAB3XP_011522370.1 Aldo_ket_red 31..300 CDD:119408 67/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5328
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.