DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3397 and AKR1C3

DIOPT Version :9

Sequence 1:NP_650140.1 Gene:CG3397 / 41454 FlyBaseID:FBgn0037975 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001240837.1 Gene:AKR1C3 / 8644 HGNCID:386 Length:323 Species:Homo sapiens


Alignment Length:331 Identity:76/331 - (22%)
Similarity:129/331 - (38%) Gaps:99/331 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 REEGILTVQEAIRSGINYIDTAPFYGQGKSEELLGQALK------DVPREAYYIATKV----ARY 108
            |.:.:...:.||.:|..:||:|..|   .:||.:|.|::      .|.||..:..:|:    .|.
Human    31 RSKALEVTKLAIEAGFRHIDSAHLY---NNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRP 92

  Fly   109 ELDPNNMFDYTAAKARESVKRSLELLQLDRVDVLQVH--------------DVDAAPSLDMV-LN 158
            ||            .|.:::.||:..|||.||:..:|              |.:.....|:| |.
Human    93 EL------------VRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLC 145

  Fly   159 ETIPVLEEYVQAGKARFIGVTAYDVDVLKECAERGKGRIQVVLN------------------YAR 205
            .|...:|:...||.|:.|||:.::           :.:::::||                  :.|
Human   146 TTWEAMEKCKDAGLAKSIGVSNFN-----------RRQLEMILNKPGLKYKPVCNQVECHPYFNR 199

  Fly   206 YTLLDNTLLRHMKAFQEMGVGVVCAAAHSLGLLSNAGPQSW-HPGSPELL------AVGKRGAEI 263
            ..|||....:          .:|..|..:||   :...:.| .|.||.||      |:.|:    
Human   200 SKLLDFCKSK----------DIVLVAYSALG---SQRDKRWVDPNSPVLLEDPVLCALAKK---- 247

  Fly   264 CQKRNVELGKLAMYYTMQLDGAATFLIGIPNRKLLRINLDAIFDGLTSHEQEVLQYLRENV-FTK 327
             .||...|  :|:.|  ||......|....|.:.:|.|:......||:.:.:.:..|..|: :..
Human   248 -HKRTPAL--IALRY--QLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFN 307

  Fly   328 SYSWGS 333
            |.|:.|
Human   308 SDSFAS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3397NP_650140.1 Tas 22..304 CDD:223739 69/299 (23%)
Aldo_ket_red 24..322 CDD:294321 72/317 (23%)
AKR1C3NP_001240837.1 ARA1 9..305 CDD:223729 73/321 (23%)
Tas 17..297 CDD:223739 71/313 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.